PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr11P10940_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TCP
Protein Properties Length: 287aa    MW: 29895.2 Da    PI: 9.808
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr11P10940_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP125.27e-3964143281
                     TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssss 81 
                             a+k+++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++ti+WLlqqa+p+i+++tgt++++as+  a++s s 
  GSMUA_Achr11P10940_001  64 APKRSSNKDRHTKVDGRGRRIRMPALCAARIFQLTRELGHKSDGETIQWLLQQAEPSIIAATGTGTIPASAIAAAASASI 143
                             789******************************************************************88744444433 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036346.9E-3269245IPR005333Transcription factor, TCP
PROSITE profilePS5136928.0770124IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MDPKGSSKLP QEVPNFHLQS DKSEPTTPPA TAAAESRDLS ASAGLERGRQ VVVAGKDEQR  60
RQLAPKRSSN KDRHTKVDGR GRRIRMPALC AARIFQLTRE LGHKSDGETI QWLLQQAEPS  120
IIAATGTGTI PASAIAAAAS ASIRSHPGLW PPPVGGLNSG FLHAGAAAPS SSNLATGGGG  180
DWSMGGFMPR IGLHGLEFPG GNLGAVSFAA MLGGHGQQLP GLELGLSPEG HIGAMNPQGL  240
SQFYQQMGQG RGGVGGGGSG QLHHHHHQQQ QHQQQARSEN DSQGSEQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6159031e-113JX615903.1 Gossypium hirsutum clone NBRI_GE60175 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009383326.11e-144PREDICTED: transcription factor TCP20-like
SwissprotQ9LSD53e-61TCP20_ARATH; Transcription factor TCP20
TrEMBLM0RR740.0M0RR74_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P10940_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28643269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27010.15e-34TCP family protein